PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family WRKY
Protein Properties Length: 546aa    MW: 60544.4 Da    PI: 7.5761
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27140.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.64.5e-32187244260
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                 dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  KFK27140.1 187 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 244
                 8****************************************.***************85 PP

2WRKY104.94.4e-33358416159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK+v+g+++prsYY+Ct +gCpv+k+ver+++dpk+v++tYeg+H+h+
  KFK27140.1 358 LDDGYRWRKYGQKVVRGNPNPRSYYKCTATGCPVRKHVERASHDPKAVITTYEGKHDHD 416
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.766181245IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-27183245IPR003657WRKY domain
SuperFamilySSF1182903.53E-25184245IPR003657WRKY domain
SMARTSM007743.5E-34186244IPR003657WRKY domain
PfamPF031061.6E-24187243IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.1E-37343418IPR003657WRKY domain
SuperFamilySSF1182905.75E-29350418IPR003657WRKY domain
PROSITE profilePS5081138.205353418IPR003657WRKY domain
SMARTSM007747.5E-38358417IPR003657WRKY domain
PfamPF031061.9E-25359415IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MDPNRKDFRV DSDCGGGGGA RYKLMSPAKL PITRSTCITI PPGLSPTSFL ESPVLLSNIK  60
AEPSPTTGSL FKPQAVHANS SSYTARTIHQ SILDEQKSSE FEFRPPASNM FYAELDKHRN  120
EAPLQFQSQG HNFKHSSSEA AASSSEINRQ TVPHRTTPSG SERSDPDESI QTTQTDSRGS  180
APAVLADDGY NWRKYGQKHV KGSEFPRSYY KCTHPNCEVK KLFERSHDGQ ITEIIYKGTH  240
DHPKPQPSRR NSGGLVMPAQ EERLDKYPSL NGRDEKGSSF YNLSPPVEQN GNPDVSPVSA  300
NEDGGDVAMS NRNNDDMDNN DPFSKRRRLD GAMEITPLVK PIREPRVVVQ TLSEVDILDD  360
GYRWRKYGQK VVRGNPNPRS YYKCTATGCP VRKHVERASH DPKAVITTYE GKHDHDVPTA  420
RSNNNNNNHD MPVPRFRPEE TTDTISLDLG VGISSGGPDN TSNEHPNQQQ QHHIRSEFVH  480
QSQTNGAAGF RFVHGPPMGS YYTNSLNAGM NHQYNSSRET GNGSQTGDIS SSYTFPHNIG  540
RIQTGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-36185418877Probable WRKY transcription factor 4
2lex_A5e-36185418877Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1324328KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006401438.10.0hypothetical protein EUTSA_v10013115mg
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A087GB880.0A0A087GB88_ARAAL; Uncharacterized protein
STRINGscaffold_701634.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31332867
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein